PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g24530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family WOX
Protein Properties Length: 113aa    MW: 12957.9 Da    PI: 10.7728
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g24530genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.6e-201271357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                +R+++tkeq++ Le+l+ +  r+psae++++++ +l    +++ ++V++WFqN++a++++
  CA06g24530 12 SRWNPTKEQIDLLESLYGQgIRTPSAEQIQQITGRLrafgHIEGKNVFYWFQNHKARQRQ 71
                6*****************99**************************************97 PP

2Wus_type_Homeobox114.45.6e-371172364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        +RW+Pt+eQi +Le+ly +G+rtP++e+iq+it +L+++G+ie+kNVfyWFQN+kaR+rqk
         CA06g24530 11 GSRWNPTKEQIDLLESLYGQGIRTPSAEQIQQITGRLRAFGHIEGKNVFYWFQNHKARQRQK 72
                       58***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.398772IPR001356Homeobox domain
SMARTSM003892.9E-4976IPR001356Homeobox domain
SuperFamilySSF466893.34E-121076IPR009057Homeodomain-like
PfamPF000462.5E-181271IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-81271IPR009057Homeodomain-like
CDDcd000862.22E-51373No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 113 aa     Download sequence    Send to blast
MLTTSGGTPV GSRWNPTKEQ IDLLESLYGQ GIRTPSAEQI QQITGRLRAF GHIEGKNVFY  60
WFQNHKARQR QKEKQDKFAY FNQFLLRTPV FPPPNCPNGK FLLLFLLSGR FI*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754453e-90HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016576871.12e-68PREDICTED: WUSCHEL-related homeobox 2
SwissprotQ6X7K12e-45WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLK4C9W12e-60K4C9W1_SOLLC; Uncharacterized protein
TrEMBLM1CZ362e-60M1CZ36_SOLTU; Uncharacterized protein
STRINGSolyc06g076000.1.15e-60(Solanum lycopersicum)
STRINGPGSC0003DMT4000779475e-60(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-46WUSCHEL related homeobox 2